bionic (1) ncbi-seg.1.gz

Provided by: ncbi-seg_0.0.20000620-4_amd64 bug

NAME

       ncbi-seg - segment sequence(s) by local complexity

SYNOPSIS

       ncbi-seg sequence [ W ] [ K(1) ] [ K(2) ] [ -x ] [ options ]

DESCRIPTION

       ncbi-seg divides sequences into contrasting segments of low-complexity and high-complexity.  Low-
       complexity segments defined by the algorithm represent "simple sequences" or "compositionally-biased
       regions".

       Locally-optimized low-complexity segments are produced at defined levels of stringency, based on formal
       definitions of local compositional complexity (Wootton & Federhen, 1993).  The segment lengths and the
       number of segments per sequence are determined automatically by the algorithm.

       The input is a FASTA-formatted sequence file, or a database file containing many FASTA-formatted
       sequences.  ncbi-seg is tuned for amino acid sequences.  For nucleotide sequences, see EXAMPLES OF
       PARAMETER SETS below.

       The stringency of the search for low-complexity segments is determined by three user-defined parameters,
       trigger window length [ W ], trigger complexity [ K(1) ] and extension complexity [ K(2)] (see below
       under PARAMETERS ).  The defaults provided are suitable for low-complexity masking of database search
       query sequences [ -x option required, see below].

OUTPUTS AND APPLICATIONS

       (1) Readable segmented sequence [Default].  Regions of contrasting complexity are displayed in "tree
       format".  See EXAMPLES.

       (2) Low-complexity masking (see Altschul et al, 1994).  Produce a masked FASTA-formatted file, ready for
       input as a query sequence for database search programs such as BLAST or FASTA.  The amino acids in low-
       complexity regions are replaced with "x" characters [-x option].  See EXAMPLES.

       (3) Database construction.  Produce FASTA-formatted files containing low-complexity segments [-l
       option], or high-complexity segments [-h option], or both [-a option].  Each segment is a separate
       sequence entry with an informative header line.

ALGORITHM

       The SEG algorithm has two stages.  First, identification of approximate raw segments of low- complexity;
       second local optimization.

       At the first stage, the stringency and resolution of the search for low-complexity segments is determined
       by the W, K(1) and K(2) parameters.  All trigger windows are defined, including overlapping windows, of
       length W and complexity less than or equal to K(1).  "Complexity" here is defined by equation  (3) of
       Wootton & Federhen (1993).  Each trigger window is then extended into a contig in both directions by
       merging with extension windows, which are overlapping windows of length W and complexity  less than or
       equal to K(2).  Each contig is a raw segment.

       At the second stage, each raw segment is reduced to a single optimal low-complexity segment, which  may
       be the entire raw segment but is usually a subsequence.  The optimal subsequence has the lowest  value of
       the probability P(0) (equation (5) of Wootton & Federhen, 1993).

PARAMETERS

       These three numeric parameters are in obligatory order after the sequence file name.

       Trigger window length [ W ].  An integer greater than zero [ Default 12 ].

       Trigger complexity. [ K1 ].  The maximum complexity of a trigger window in units of bits. K1 must  be
       equal to or greater than zero.  The maximum value is 4.322 (log[base 2]20) for amino acid sequences [
       Default 2.2 ].

       Extension complexity [ K2 ].  The maximum complexity of an extension window in units of bits.  Only
       values greater than K1 are effective in extending triggered windows.  Range of possible values is as for
       K1 [ Default 2.5 ].

OPTIONS

       The following options may be placed in any order in the command line after the W, K1 and K2 parameters:

       -a  Output both low-complexity and high-complexity segments in a FASTA-formatted file, as a set of
           separate entries with header lines.

       -c  [characters-per-line]
           Number of sequence characters per line of output [Default 60].  Other characters, such as residue
           numbers, are additional.

       -h  Output only the high-complexity segments in a FASTA-formatted file, as a set of separate entries
           with header lines.

       -l  Output only the low-complexity segments in a FASTA-formatted file, as a set of separate entries with
           header lines.

       -m  [length]
           Minimum length in residues for a high-complexity segment [default 0].  Shorter segments are merged
           with adjacent low-complexity segments.

       -o  Show all overlapping, independently-triggered low-complexity segments [these are merged by default].

       -q  Produce an output format with the sequence in a numbered block with markings to assist residue
           counting.  The low-complexity and high-complexity segments are in lower- and upper-case characters
           respectively.

       -t  [length]
           "Maximum trim length" parameter [default 100]. This controls the search space (and  search time)
           during the optimization of raw segments (see ALGORITHM above).  By default, subsequences 100 or more
           residues shorter than the raw segment are omitted from the search. This parameter may be increased to
           give a more extensive search if raw segments are longer than 100 residues.

       -x  The masking option for amino acid sequences.  Each input sequence is represented by a single output
           sequence in FASTA-format with low-complexity regions replaced by strings of "x" characters.

EXAMPLES OF PARAMETER SETS

       Default parameters are given by 'ncbi-seg sequence' (equivalent to 'ncbi-seg sequence 12 2.2 2.5').
       These  parameters are appropriate for low- complexity masking of many amino acid sequences [with -x
       option  ].

   Database-database comparisons:
       More stringent (lower) complexity parameters are suitable when masked sequences are compared with masked
       sequences.  For example, for BLAST or FASTA searches that compare two amino acid sequence databases, the
       following masking may be applied to both databases:

         ncbi-seg database 12 1.8 2.0 -x

   Homopolymer analysis:
       To examine all homopolymeric subsequences of length (for example) 7 or greater:

         ncbi-seg sequence 7 0 0

   Non-globular regions of protein sequences:
       Many long non-globular domains may be diagnosed at longer window lengths, typically:

         ncbi-seg sequence 45 3.4 3.75

       For some shorter non-globular domains, the following set is appropriate:

         ncbi-seg sequence 25 3.0 3.3

   Nucleotide sequences:
       The maximum value of the complexity parameters is 2 (log[base 2]4).  For masking, the following is
       approximately equivalent in effect to the default parameters for amino acid sequences:

         ncbi-seg sequence.na 21 1.4 1.6

EXAMPLES

       The following is a file named 'prion' in FASTA format:

        >PRIO_HUMAN MAJOR PRION PROTEIN PRECURSOR
        MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQP
        HGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGA
        VVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV
        NITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPV
        ILLISFLIFLIVG

       The command line:

        ncbi-seg /usr/share/doc/ncbi-seg/examples/prion.fa

       gives the standard output below

        >PRIO_HUMAN MAJOR PRION PROTEIN PRECURSOR

                                          1-49   MANLGCWMLVLFVATWSDLGLCKKRPKPGG
                                                 WNTGGSRYPGQGSPGGNRY
        ppqggggwgqphgggwgqphgggwgqphgg   50-94
                       gwgqphgggwgqggg
                                         95-112  THSQWNKPSKPKTNMKHM
               agaaaagavvgglggymlgsams  113-135
                                        136-187  RPIIHFGSDYEDRYYRENMHRYPNQVYYRP
                                                 MDEYSNQNNFVHDCVNITIKQH
                        tvttttkgenftet  188-201
                                        202-236  DVKMMERVVEQMCITQYERESQAYYQRGSS
                                                 MVLFS
                      sppvillisflifliv  237-252
                                        253-253  G

       The low-complexity sequences are on the left (lower case) and high-complexity sequences are on the right
       (upper case).  All sequence segments read from left to right and their order in the sequence is from top
       to bottom, as shown by the central column of residue numbers.

       The command line:

         ncbi-seg /usr/share/doc/ncbi-seg/examples/prion.fa -x

       gives the following FASTA-formatted file:-

        >PRIO_HUMAN MAJOR PRION PROTEIN PRECURSOR
        MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYxxxxxxxxxxx
        xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTHSQWNKPSKPKTNMKHMxxxxxxxx
        xxxxxxxxxxxxxxxRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV
        NITIKQHxxxxxxxxxxxxxxDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSxxxx
        xxxxxxxxxxxxG

SEE ALSO

       segn(1), blast(1), saps(1), xnu(1)

AUTHORS

       John Wootton:     wootton@ncbi.nlm.nih.gov

       Scott Federhen:   federhen@ncbi.nlm.nih.gov

        National Center for Biotechnology Information
        Building 38A, Room 8N805
        National Library of Medicine
        National Institutes of Health
        Bethesda, Maryland, MD 20894
        U.S.A.

PRIMARY REFERENCE

       Wootton, J.C., Federhen, S. (1993)  Statistics of local complexity in amino acid sequences and sequence
       databases.  Computers & Chemistry 17: 149-163.

OTHER REFERENCES

       Wootton, J.C. (1994)  Non-globular domains in protein sequences: automated segmentation using complexity
       measures.  Computers & Chemistry 18: (in press).

       Altschul, S.F., Boguski, M., Gish, W., Wootton, J.C. (1994)  Issues in searching molecular sequence
       databases.  Nature Genetics 6: 119-129.

       Wootton, J.C. (1994)  Simple sequences of protein and DNA. In: Nucleic Acid and Protein Sequence
       Analysis: A Practical Approach.  (Second Edition, Chapter 8, Bishop, M.J. and Rawlings, C.R. Eds.  IRL
       Press, Oxford) (In press).