Ubuntu Manpages

Boulder::Genbank

Fetch Genbank data records as parsed Boulder Stones

  use Boulder::Genbank
  
  # network access via Entrez
   $gb = Boulder::Genbank->newFh( qw(M57939 M28274 L36028) );
   while ($data = <$gb>) {
       print $data->Accession;
       @introns = $data->features->Intron;
       print "There are ",scalar(@introns)," introns.\n";
       $dna = $data->Sequence;
       print "The dna is ",length($dna)," bp long.\n";     
       my @features = $data->features(-type=>[ qw(Exon Source Satellite) ], 
                                      -pos=>[90,310] );
       foreach (@features) {
          print $_->Type,"\n";
          print $_->Position,"\n";
          print $_->Gene,"\n";
      }
    }
  # another syntax
  $gb = new Boulder::Genbank(-accessor=>'Entrez',
                             -fetch => [qw/M57939 M28274 L36028/]);
  # local access via Yank
  $gb = new Boulder::Genbank(-accessor=>'Yank',
                             -fetch=>[qw/M57939 M28274 L36028/]);
  while (my $s = $gb->get) {
     # etc.
  }
  # parse a file of Genbank records
  $gb = new Boulder::Genbank(-accessor=>'File',
                             -fetch => '/usr/local/db/gbpri3.seq');
  while (my $s = $gb->get) {
     # etc.
  }
  # parse flatfile records yourself
  open (GB,"/usr/local/db/gbpri3.seq");
  local $/ = "//\n";
  while (<GB>) {
     my $s = Boulder::Genbank->parse($_);
     # etc.
  }

Boulder::Genbank provides retrieval and parsing services for NCBI Genbank-format records. It returns Genbank entries in Stone format, allowing easy access to the various fields and values. Boulder::Genbank is a descendent of Boulder::Stream, and provides a stream-like interface to a series of Stone objects.

>> IMPORTANT NOTE <<

As of January 2002, NCBI has changed their Batch Entrez interface. I have modified Boulder::Genbank so as to use a "demo" interface, which fixes things, but this isn't guaranteed in the long run.

I have written to NCBI, and they may fix this -- or they may not.

>> IMPORTANT NOTE <<

Access to Genbank is provided by three different accessors, which together give access to remote and local Genbank databases. When you create a new Boulder::Genbank stream, you provide one of the three accessors, along with accessor-specific parameters that control what entries to fetch. The three accessors are:

This provides access to NetEntrez, accessing the most recent Genbank information directly from NCBI's Web site. The parameters passed to this accessor are either a series of Genbank accession numbers, or an Entrez query (see http://www.ncbi.nlm.nih.gov/Entrez/linking.html). If you provide a list of accession numbers, the stream will return a series of stones corresponding to the numbers. Otherwise, if you provided an Entrez query, the entries returned will be in the order returned by Entez.
This provides access to local Genbank entries by reading from a flat file (typically one of the .seq files downloadable from NCBI's Web site). The stream will return a Stone corresponding to each of the entries in the file, starting from the top of the file and working downward. The parameter in this case is the path to the local file.
This provides access to local Genbank entries using Will Fitzhugh's Yank program. Yank provides fast indexed access to a Genbank flat file using the accession number as the key. The parameter passed to the Yank accessor is a list of accession numbers. Stones will be returned in the requested order. By default the yank binary lives in /usr/local/bin/yank. To support other locations, you may define the environment variable YANK to contain the full path.

It is also possible to parse a single Genbank entry from a text string stored in a scalar variable, returning a Stone object.

This section lists the public methods that the Boulder::Genbank class makes available.

   # Network fetch via Entrez, with accession numbers
   $gb=new Boulder::Genbank(-accessor  =>  'Entrez',
                            -fetch     =>  [qw/M57939 M28274 L36028/]);
   # Same, but shorter and uses -> operator
   $gb = Boulder::Genbank->new qw(M57939 M28274 L36028);
   # Network fetch via Entrez, with a query
   # Network fetch via Entrez, with a query
   $query = 'Homo sapiens[Organism] AND EST[Keyword]';
   $gb=new Boulder::Genbank(-accessor  =>  'Entrez',
                            -fetch     =>  $query);
   # Local fetch via Yank, with accession numbers
   $gb=new Boulder::Genbank(-accessor  =>  'Yank',
                            -fetch     =>  [qw/M57939 M28274 L36028/]);
   # Local fetch via File
   $gb=new Boulder::Genbank(-accessor  =>  'File',
                            -fetch     =>  '/usr/local/genbank/gbpri3.seq');
    

The new() method creates a new Boulder::Genbank stream on the accessor provided. The three possible accessors are Entrez, Yank and File. If successful, the method returns the stream object. Otherwise it returns undef.

new() takes the following arguments:

        -accessor       Name of the accessor to use
        -fetch          Parameters to pass to the accessor
        -proxy          Path to an HTTP proxy, used when using
                         the Entrez accessor over a firewall.
    

Specify the accessor to use with the -accessor argument. If not specified, it defaults to Entrez.

-fetch is an accessor-specific argument. The possibilities are:

For Entrez, the -fetch argument may point to a scalar, in which case it is interpreted as an Entrez query string. See http://www.ncbi.nlm.nih.gov/Entrez/linking.html for a description of the query syntax. Alternatively, -fetch may point to an array reference, in which case it is interpreted as a list of accession numbers to retrieve. If -fetch points to a hash, it is interpreted as extended information. See "Extended Entrez Parameters" below.

For Yank, the -fetch argument must point to an array reference containing the accession numbers to retrieve.

For File, the -fetch argument must point to a string-valued scalar, which will be interpreted as the path to the file to read Genbank entries from.

For Entrez (and Entrez only) Boulder::Genbank allows you to use a shortcut syntax in which you provde new() with a list of accession numbers:

  $gb = new Boulder::Genbank('M57939','M28274','L36028');
    
This works like new(), but returns a filehandle. To recover each GenBank record read from the filehandle with the <> operator:

  $fh = Boulder::GenBank->newFh('M57939','M28274','L36028');
  while ($record = <$fh>) {
     print $record->asString;
  }
    
The get() method is inherited from Boulder::Stream, and simply returns the next parsed Genbank Stone, or undef if there is nothing more to fetch. It has the same semantics as the parent class, including the ability to restrict access to certain top-level tags.

The object returned is a Stone::GB_Sequence object, which is a descendent of Stone.

The put() method is inherited from the parent Boulder::Stream class, and will write the passed Stone to standard output in Boulder format. This means that it is currently not possible to write a Boulder::Genbank object back into Genbank flatfile form.

The Entrez accessor recognizes extended parameters that allow you the ability to customize the search. Instead of passing a query string scalar or a list of accession numbers as the -fetch argument, pass a hash reference. The hashref should contain one or more of the following keys:

The Entrez query to process.
The list of accession numbers to fetch, as an array ref.
The database to search. This is a single-letter database code selected from the following list:

  m  MEDLINE
  p  Protein
  n  Nucleotide
  s  Popset
    
An HTTP proxy to use. For example:

   -proxy => http://www.firewall.com:9000
    

If you think you need this, get the correct URL from your system administrator.

As an example, here's how to search for ESTs from Oryza sativa that have been entered or modified since 1999.

  my $gb = new Boulder::Genbank( -accessor=>Entrez, 
                                 -query=>'Oryza sativa[Organism] AND EST[Keyword] AND 1999[MDAT]', 
                                 -db   => 'n'   
                                });

Each record returned from the Boulder::Genbank stream defines a set of methods that correspond to features and other fields in the Genbank flat file record. Stone::GB_Sequence gives the full details, but they are listed for reference here:

Get the length of the sequence.

Get the start position of the sequence, currently always "1".

Get the end position of the sequence, currently always the same as the length.

features() will search the entry feature list for those features that meet certain criteria. The criteria are specified using the -pos and/or -type argument names, as shown below.

Provide a position or range of positions which the feature must overlap. A single position is specified in this way:

   -pos => 1500;         # feature must overlap postion 1500
    

or a range of positions in this way:

   -pos => [1000,1500];  # 1000 to 1500 inclusive
    

If no criteria are provided, then features() returns all the features, and is equivalent to calling the Features() accessor.

Filter the list of features by type or a set of types. Matches are case-insensitive, so "exon", "Exon" and "EXON" are all equivalent. You may call with a single type as in:

   -type => 'Exon'
    

or with a list of types, as in

   -types => ['Exon','CDS']
    

The names "-type" and "-types" can be used interchangeably.

Returns a Bio::Seq object from the Bioperl project. Dies with an error message unless the Bio::Seq module is installed.

The tags returned by the parsing operation are taken from the NCBI ASN.1 schema. For consistency, they are normalized so that the initial letter is capitalized, and all subsequent letters are lowercase. This section contains an abbreviated list of the most useful/common tags. See "The NCBI Data Model", by James Ostell and Jonathan Kans in "Bioinformatics: A Practical Guide to the Analysis of Genes and Proteins" (Eds. A. Baxevanis and F. Ouellette), pp 121-144 for the full listing.

These are tags that appear at the top level of the parsed Genbank entry.

The accession number of this entry. Because of the vagaries of the Genbank data model, an entry may have multiple accession numbers (e.g. after a merging operation). Accession may therefore be a multi-valued tag.

Example:

      my $accessionNo = $s->Accession;
    
The list of authors, as they appear on the AUTHORS line of the Genbank record. No attempt is made to parse them into individual authors.
The nucleotide basecount for the entry. It is presented as a Boulder Stone with keys "a", "c", "t" and "g". Example:

     my $A = $s->Basecount->A;
     my $C = $s->Basecount->C;
     my $G = $s->Basecount->G;
     my $T = $s->Basecount->T;
     print "GC content is ",($G+$C)/($A+$C+$G+$T),"\n";
    
The entire flatfile record as an unparsed chunk of text (a "blob"). This is a handy way of reassembling the record for human inspection.
The COMMENT line from the Genbank record.
The DEFINITION line from the Genbank record, unmodified.
The FEATURES table. This is a complex stone object with multiple subtags. See the "The Features Tag" for details.
The JOURNAL line from the Genbank record, unmodified.
The KEYWORDS line from the Genbank record, unmodified. No attempt is made to parse the keywords into separate values.

Example:

    my $keywords = $s->Keywords
    
The LOCUS line from the Genbank record. It is not further parsed.
References to other database accession numbers.
The taxonomic name of the organism from which this entry was derived. This line is taken from the Genbank entry unmodified. See the NCBI data model documentation for an explanation of their taxonomic syntax.
The REFERENCE line from the Genbank entry. There are often multiple Reference lines. Example:

  my @references = $s->Reference;
    
The DNA or RNA sequence of the entry. This is presented as a single lower-case string, with all base numbers and formatting characters removed.
The entry's SOURCE field; often giving clues on how the sequencing was performed.
The TITLE field from the paper describing this entry, if any.

The Features tag points to a Stone record that contains multiple subtags. Each subtag is the name of a feature which points, in turn, to a Stone that describes the feature's location and other attributes. The full list of feature is beyond this document, but the following are the features that are most often seen:

        Cds             a CDS
        Intron          an intron
        Exon            an exon
        Gene            a gene
        Mrna            an mRNA
        Polya_site      a putative polyadenylation signal
        Repeat_unit     a repetitive region
        Source          More information about the organism and cell
                        type the sequence was derived from
        Satellite       a microsatellite (dinucleotide repeat)

Each feature will contain one or more of the following subtags:

A cross-reference to another database in the form DB_NAME:accession_number. See the NCBI Web site for a description of these cross references.
The evidence for this feature, either "experimental" or "predicted".
If the feature involves a gene, this will be the gene's name (or one of its names). This subtag is often seen in "Gene" and Cds features.

Example:

        foreach ($s->Features->Cds) {
           my $gene = $_->Gene;
           my $position = $_->Position;
           Print "Gene $gene ($position)\n";
        }
    
If the feature is mapped, this provides a map position, usually as a cytogenetic band.
A grab-back for various text notes.
When multiple features of this type occur, this field is used to number them. Ordinarily this field is not needed because Boulder::Genbank preserves the order of features.
If the feature is Source, this provides the source organism.
The position of this feature, usually expresed as a range (1970..1975).
The protein product of the feature, if applicable, as a text string.
The protein translation of the feature, if applicable.

Boulder, Boulder::Blast

Lincoln Stein <lstein@cshl.org>.

Copyright (c) 1997-2000 Lincoln D. Stein

This library is free software; you can redistribute it and/or modify it under the same terms as Perl itself. See DISCLAIMER.txt for disclaimers of warranty.

The following is an excerpt from a moderately complex Genbank Stone. The Sequence line and several other long lines have been truncated for readability.

 Authors=Spritz,R.A., Strunk,K., Surowy,C.S.O., Hoch,S., Barton,D.E. and Francke,U.
 Authors=Spritz,R.A., Strunk,K., Surowy,C.S. and Mohrenweiser,H.W.
 Locus=HUMRNP7011   2155 bp    DNA             PRI       03-JUL-1991
 Accession=M57939
 Accession=J04772
 Accession=M57733
 Keywords=ribonucleoprotein antigen.
 Sequence=aagcttttccaggcagtgcgagatagaggagcgcttgagaaggcaggttttgcagcagacggcagtgacagcccag...
 Definition=Human small nuclear ribonucleoprotein (U1-70K) gene, exon 10 and 11.
 Journal=Nucleic Acids Res. 15, 10373-10391 (1987)
 Journal=Genomics 8, 371-379 (1990)
 Nid=g337441
 Medline=88096573
 Medline=91065657
 Features={
   Polya_site={
     Evidence=experimental
     Position=1989 
     Gene=U1-70K
   }
   Polya_site={
     Position=1990 
     Gene=U1-70K
   }
   Polya_site={
     Evidence=experimental
     Position=1992 
     Gene=U1-70K
   }
   Polya_site={
     Evidence=experimental
     Position=1998 
     Gene=U1-70K
   }
   Source={
     Organism=Homo sapiens
     Db_xref=taxon:9606
     Position=1..2155 
     Map=19q13.3
   }
   Cds={
     Codon_start=1 
     Product=ribonucleoprotein antigen
     Db_xref=PID:g337445
     Position=join(M57929:329..475,M57930:183..245,M57930:358..412, ...
     Gene=U1-70K
     Translation=MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTR...
   }
   Cds={
     Codon_start=1 
     Product=ribonucleoprotein antigen
     Db_xref=PID:g337444
     Evidence=experimental 
     Position=join(M57929:329..475,M57930:183..245,M57930:358..412, ...
     Gene=U1-70K
     Translation=MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPR...
   }
   Polya_signal={
     Position=1970..1975 
     Note=putative
     Gene=U1-70K
   }
   Intron={
     Evidence=experimental
     Position=1100..1208 
     Gene=U1-70K
   }
   Intron={
     Number=10 
     Evidence=experimental
     Position=1100..1181 
     Gene=U1-70K
   }
   Intron={
     Number=9 
     Evidence=experimental
     Position=order(M57937:702..921,1..1011) 
     Note=2.1 kb gap
     Gene=U1-70K
   }
   Intron={
     Position=order(M57935:272..406,M57936:1..284,M57937:1..599, <1..>1208) 
     Gene=U1-70K
   }
   Intron={
     Evidence=experimental
     Position=order(M57935:284..406,M57936:1..284,M57937:1..599, <1..>1208) 
     Note=first gap-0.14 kb, second gap-0.62 kb
     Gene=U1-70K
   }
   Intron={
     Number=8 
     Evidence=experimental
     Position=order(M57935:272..406,M57936:1..284,M57937:1..599, <1..>1181) 
     Note=first gap-0.14 kb, second gap-0.62 kb
     Gene=U1-70K
   }
   Exon={
     Number=10 
     Evidence=experimental
     Position=1012..1099 
     Gene=U1-70K
   }
   Exon={
     Number=11 
     Evidence=experimental
     Position=1182..(1989.1998) 
     Gene=U1-70K
   }
   Exon={
     Evidence=experimental
     Position=1209..(1989.1998) 
     Gene=U1-70K
   }
   Mrna={
     Product=ribonucleoprotein antigen
     Position=join(M57928:358..668,M57929:319..475,M57930:183..245, ...
     Gene=U1-70K
   }
   Mrna={
     Product=ribonucleoprotein antigen
     Citation=[2] 
     Evidence=experimental 
     Position=join(M57928:358..668,M57929:319..475,M57930:183..245, ...
     Gene=U1-70K
   }
   Gene={
     Position=join(M57928:207..719,M57929:1..562,M57930:1..577, ...
     Gene=U1-70K
   }
 }
 Reference=1  (sites)
 Reference=2  (bases 1 to 2155)
 =